PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF044400110CFD_t1
Common NameTRAES_3BF044400110CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 267aa    MW: 29124.1 Da    PI: 8.8062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF044400110CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  TRAES3BF044400110CFD_t1 14 KGAWTKEEDQRLIGYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding54.43e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T ++del+++++++lG++ W++Ia  ++ gRt++++k++w+++
  TRAES3BF044400110CFD_t1  67 RGNFTDDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.089961IPR017930Myb domain
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-2813108IPR009057Homeodomain-like
PfamPF002495.8E-151461IPR001005SANT/Myb domain
CDDcd001677.30E-111661No hitNo description
PROSITE profilePS5129427.64762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-2765116IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.2E-1567111IPR001005SANT/Myb domain
CDDcd001671.95E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIGYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDDDELIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLNRG  120
MDPHTHCPIS AASGLTTSTT APVFPSSPAP ASRLANAPFA FQSSTVSFAR PSPSDDGHSS  180
SGGSSDAPRC PDLNLDLDLD LSMSLPCSPP KTAPPAKSTP TSHQQQGICL CYHLGVRNGE  240
ACTCKTASPA GPRVFRFLRP LEEGQYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519110.0JF951911.1 Triticum aestivum clone TaMYB28 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.11e-147hypothetical protein SORBIDRAFT_03g041360
SwissprotP813936e-92MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP11e-91MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A077S5D90.0A0A077S5D9_WHEAT; Uncharacterized protein
STRINGMLOC_69570.11e-167(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-85myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]